Anti TTC21B pAb (ATL-HPA073293)

Atlas Antibodies

SKU:
ATL-HPA073293-25
  • Immunohistochemical staining of human cerebral cortex shows strong membranous positivity in neurons.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 21B
Gene Name: TTC21B
Alternative Gene Name: FLJ11457, IFT139B, JBTS11, NPHP12, THM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034848: 77%, ENSRNOG00000034089: 50%
Entrez Gene ID: 79809
Uniprot ID: Q7Z4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHF
Gene Sequence LQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHF
Gene ID - Mouse ENSMUSG00000034848
Gene ID - Rat ENSRNOG00000034089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TTC21B pAb (ATL-HPA073293)
Datasheet Anti TTC21B pAb (ATL-HPA073293) Datasheet (External Link)
Vendor Page Anti TTC21B pAb (ATL-HPA073293) at Atlas Antibodies

Documents & Links for Anti TTC21B pAb (ATL-HPA073293)
Datasheet Anti TTC21B pAb (ATL-HPA073293) Datasheet (External Link)
Vendor Page Anti TTC21B pAb (ATL-HPA073293)