Anti TTC21B pAb (ATL-HPA073293)

Atlas Antibodies

Catalog No.:
ATL-HPA073293-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 21B
Gene Name: TTC21B
Alternative Gene Name: FLJ11457, IFT139B, JBTS11, NPHP12, THM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034848: 77%, ENSRNOG00000034089: 50%
Entrez Gene ID: 79809
Uniprot ID: Q7Z4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHF
Gene Sequence LQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHF
Gene ID - Mouse ENSMUSG00000034848
Gene ID - Rat ENSRNOG00000034089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTC21B pAb (ATL-HPA073293)
Datasheet Anti TTC21B pAb (ATL-HPA073293) Datasheet (External Link)
Vendor Page Anti TTC21B pAb (ATL-HPA073293) at Atlas Antibodies

Documents & Links for Anti TTC21B pAb (ATL-HPA073293)
Datasheet Anti TTC21B pAb (ATL-HPA073293) Datasheet (External Link)
Vendor Page Anti TTC21B pAb (ATL-HPA073293)