Anti TTC14 pAb (ATL-HPA009295)

Atlas Antibodies

Catalog No.:
ATL-HPA009295-100
Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 14
Gene Name: TTC14
Alternative Gene Name: FLJ00166, KIAA1980
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027677: 99%, ENSRNOG00000011261: 99%
Entrez Gene ID: 151613
Uniprot ID: Q96N46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen SNPPSLMRGLQSKNFSEDDFASALRKKQSASWALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQNVEALVARGALYATKGSLNKAIEDFELALENCPTHRNARKYLCQTLVERGGQLEEEEKFLNAESYYKKALALDET
Gene Sequence SNPPSLMRGLQSKNFSEDDFASALRKKQSASWALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQNVEALVARGALYATKGSLNKAIEDFELALENCPTHRNARKYLCQTLVERGGQLEEEEKFLNAESYYKKALALDET
Gene ID - Mouse ENSMUSG00000027677
Gene ID - Rat ENSRNOG00000011261
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTC14 pAb (ATL-HPA009295)
Datasheet Anti TTC14 pAb (ATL-HPA009295) Datasheet (External Link)
Vendor Page Anti TTC14 pAb (ATL-HPA009295) at Atlas Antibodies

Documents & Links for Anti TTC14 pAb (ATL-HPA009295)
Datasheet Anti TTC14 pAb (ATL-HPA009295) Datasheet (External Link)
Vendor Page Anti TTC14 pAb (ATL-HPA009295)
Citations for Anti TTC14 pAb (ATL-HPA009295) – 1 Found
Jan, Sabrina Z; Vormer, Tinke L; Jongejan, Aldo; Röling, Michael D; Silber, Sherman J; de Rooij, Dirk G; Hamer, Geert; Repping, Sjoerd; van Pelt, Ans M M. Unraveling transcriptome dynamics in human spermatogenesis. Development (Cambridge, England). 2017;144(20):3659-3673.  PubMed
!