Anti TTC1 pAb (ATL-HPA057502)

Atlas Antibodies

Catalog No.:
ATL-HPA057502-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 1
Gene Name: TTC1
Alternative Gene Name: TPR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041278: 71%, ENSRNOG00000003980: 74%
Entrez Gene ID: 7265
Uniprot ID: Q99614
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASFEEEP
Gene Sequence EKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASFEEEP
Gene ID - Mouse ENSMUSG00000041278
Gene ID - Rat ENSRNOG00000003980
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTC1 pAb (ATL-HPA057502)
Datasheet Anti TTC1 pAb (ATL-HPA057502) Datasheet (External Link)
Vendor Page Anti TTC1 pAb (ATL-HPA057502) at Atlas Antibodies

Documents & Links for Anti TTC1 pAb (ATL-HPA057502)
Datasheet Anti TTC1 pAb (ATL-HPA057502) Datasheet (External Link)
Vendor Page Anti TTC1 pAb (ATL-HPA057502)