Anti TTC1 pAb (ATL-HPA057502)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057502-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TTC1
Alternative Gene Name: TPR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041278: 71%, ENSRNOG00000003980: 74%
Entrez Gene ID: 7265
Uniprot ID: Q99614
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASFEEEP |
Gene Sequence | EKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASFEEEP |
Gene ID - Mouse | ENSMUSG00000041278 |
Gene ID - Rat | ENSRNOG00000003980 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TTC1 pAb (ATL-HPA057502) | |
Datasheet | Anti TTC1 pAb (ATL-HPA057502) Datasheet (External Link) |
Vendor Page | Anti TTC1 pAb (ATL-HPA057502) at Atlas Antibodies |
Documents & Links for Anti TTC1 pAb (ATL-HPA057502) | |
Datasheet | Anti TTC1 pAb (ATL-HPA057502) Datasheet (External Link) |
Vendor Page | Anti TTC1 pAb (ATL-HPA057502) |