Anti TSTA3 pAb (ATL-HPA023361 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023361-100

Protein Description: tissue specific transplantation antigen P35B
Gene Name: TSTA3
Alternative Gene Name: FX, P35B, SDR4E1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022570: 92%, ENSRNOG00000009020: 92%
Entrez Gene ID: 7264
Uniprot ID: Q13630
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVG
• Gene Sequence: RILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVG
• Gene ID - Mouse: ENSMUSG00000022570
• Gene ID - Rat: ENSRNOG00000009020
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.