Anti TSSC4 pAb (ATL-HPA041801)

Atlas Antibodies

Catalog No.:
ATL-HPA041801-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tumor suppressing subtransferable candidate 4
Gene Name: TSSC4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045752: 66%, ENSRNOG00000032677: 68%
Entrez Gene ID: 10078
Uniprot ID: Q9Y5U2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLGNPATD
Gene Sequence TKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLGNPATD
Gene ID - Mouse ENSMUSG00000045752
Gene ID - Rat ENSRNOG00000032677
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSSC4 pAb (ATL-HPA041801)
Datasheet Anti TSSC4 pAb (ATL-HPA041801) Datasheet (External Link)
Vendor Page Anti TSSC4 pAb (ATL-HPA041801) at Atlas Antibodies

Documents & Links for Anti TSSC4 pAb (ATL-HPA041801)
Datasheet Anti TSSC4 pAb (ATL-HPA041801) Datasheet (External Link)
Vendor Page Anti TSSC4 pAb (ATL-HPA041801)