Anti TSPYL4 pAb (ATL-HPA044863)

Atlas Antibodies

Catalog No.:
ATL-HPA044863-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TSPY-like 4
Gene Name: TSPYL4
Alternative Gene Name: dJ486I3.2, KIAA0721
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039485: 81%, ENSRNOG00000000547: 79%
Entrez Gene ID: 23270
Uniprot ID: Q9UJ04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MIPGKKAKEVTTKKRAISAAVEKEGEAGAAMEEKKVVQKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNA
Gene Sequence MIPGKKAKEVTTKKRAISAAVEKEGEAGAAMEEKKVVQKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNA
Gene ID - Mouse ENSMUSG00000039485
Gene ID - Rat ENSRNOG00000000547
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSPYL4 pAb (ATL-HPA044863)
Datasheet Anti TSPYL4 pAb (ATL-HPA044863) Datasheet (External Link)
Vendor Page Anti TSPYL4 pAb (ATL-HPA044863) at Atlas Antibodies

Documents & Links for Anti TSPYL4 pAb (ATL-HPA044863)
Datasheet Anti TSPYL4 pAb (ATL-HPA044863) Datasheet (External Link)
Vendor Page Anti TSPYL4 pAb (ATL-HPA044863)