Anti TSPY4 pAb (ATL-HPA049384)

Atlas Antibodies

Catalog No.:
ATL-HPA049384-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: testis specific protein, Y-linked 4
Gene Name: TSPY4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047514: 37%, ENSRNOG00000000549: 38%
Entrez Gene ID: 728395
Uniprot ID: P0CV99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAF
Gene Sequence EEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAF
Gene ID - Mouse ENSMUSG00000047514
Gene ID - Rat ENSRNOG00000000549
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSPY4 pAb (ATL-HPA049384)
Datasheet Anti TSPY4 pAb (ATL-HPA049384) Datasheet (External Link)
Vendor Page Anti TSPY4 pAb (ATL-HPA049384) at Atlas Antibodies

Documents & Links for Anti TSPY4 pAb (ATL-HPA049384)
Datasheet Anti TSPY4 pAb (ATL-HPA049384) Datasheet (External Link)
Vendor Page Anti TSPY4 pAb (ATL-HPA049384)