Anti TSPY1 pAb (ATL-HPA067289)

Atlas Antibodies

Catalog No.:
ATL-HPA067289-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: testis specific protein, Y-linked 1
Gene Name: TSPY1
Alternative Gene Name: CT78, TSPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 38%, ENSRNOG00000023781: 38%
Entrez Gene ID: 7258
Uniprot ID: Q01534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGE
Gene Sequence CGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGE
Gene ID - Mouse ENSMUSG00000022565
Gene ID - Rat ENSRNOG00000023781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSPY1 pAb (ATL-HPA067289)
Datasheet Anti TSPY1 pAb (ATL-HPA067289) Datasheet (External Link)
Vendor Page Anti TSPY1 pAb (ATL-HPA067289) at Atlas Antibodies

Documents & Links for Anti TSPY1 pAb (ATL-HPA067289)
Datasheet Anti TSPY1 pAb (ATL-HPA067289) Datasheet (External Link)
Vendor Page Anti TSPY1 pAb (ATL-HPA067289)