Anti TSPY1 pAb (ATL-HPA067289)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067289-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TSPY1
Alternative Gene Name: CT78, TSPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 38%, ENSRNOG00000023781: 38%
Entrez Gene ID: 7258
Uniprot ID: Q01534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGE |
| Gene Sequence | CGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGE |
| Gene ID - Mouse | ENSMUSG00000022565 |
| Gene ID - Rat | ENSRNOG00000023781 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TSPY1 pAb (ATL-HPA067289) | |
| Datasheet | Anti TSPY1 pAb (ATL-HPA067289) Datasheet (External Link) |
| Vendor Page | Anti TSPY1 pAb (ATL-HPA067289) at Atlas Antibodies |
| Documents & Links for Anti TSPY1 pAb (ATL-HPA067289) | |
| Datasheet | Anti TSPY1 pAb (ATL-HPA067289) Datasheet (External Link) |
| Vendor Page | Anti TSPY1 pAb (ATL-HPA067289) |