Anti TSPY1 pAb (ATL-HPA067289)

Atlas Antibodies

Catalog No.: ATL-HPA067289-25

Protein Description: testis specific protein, Y-linked 1
Gene Name: TSPY1
Alternative Gene Name: CT78, TSPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 38%, ENSRNOG00000023781: 38%
Entrez Gene ID: 7258
Uniprot ID: Q01534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGE
• Gene Sequence: CGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGE
• Gene ID - Mouse: ENSMUSG00000022565
• Gene ID - Rat: ENSRNOG00000023781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.