Anti TSPAN31 pAb (ATL-HPA057489)

Atlas Antibodies

Catalog No.:
ATL-HPA057489-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tetraspanin 31
Gene Name: TSPAN31
Alternative Gene Name: SAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006736: 75%, ENSRNOG00000025592: 71%
Entrez Gene ID: 6302
Uniprot ID: Q12999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKF
Gene Sequence DVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKF
Gene ID - Mouse ENSMUSG00000006736
Gene ID - Rat ENSRNOG00000025592
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSPAN31 pAb (ATL-HPA057489)
Datasheet Anti TSPAN31 pAb (ATL-HPA057489) Datasheet (External Link)
Vendor Page Anti TSPAN31 pAb (ATL-HPA057489) at Atlas Antibodies

Documents & Links for Anti TSPAN31 pAb (ATL-HPA057489)
Datasheet Anti TSPAN31 pAb (ATL-HPA057489) Datasheet (External Link)
Vendor Page Anti TSPAN31 pAb (ATL-HPA057489)