Anti TSPAN3 pAb (ATL-HPA015996)

Atlas Antibodies

Catalog No.: ATL-HPA015996-25

Protein Description: tetraspanin 3
Gene Name: TSPAN3
Alternative Gene Name: TM4-A, TM4SF8, TSPAN-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032324: 95%, ENSRNOG00000016474: 95%
Entrez Gene ID: 10099
Uniprot ID: O60637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEI
• Gene Sequence: NGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEI
• Gene ID - Mouse: ENSMUSG00000032324
• Gene ID - Rat: ENSRNOG00000016474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.