Anti TSPAN15 pAb (ATL-HPA071160)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071160-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TSPAN15
Alternative Gene Name: NET-7, TM4SF15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037031: 81%, ENSRNOG00000046204: 84%
Entrez Gene ID: 23555
Uniprot ID: O95858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN |
| Gene Sequence | RVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN |
| Gene ID - Mouse | ENSMUSG00000037031 |
| Gene ID - Rat | ENSRNOG00000046204 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TSPAN15 pAb (ATL-HPA071160) | |
| Datasheet | Anti TSPAN15 pAb (ATL-HPA071160) Datasheet (External Link) |
| Vendor Page | Anti TSPAN15 pAb (ATL-HPA071160) at Atlas Antibodies |
| Documents & Links for Anti TSPAN15 pAb (ATL-HPA071160) | |
| Datasheet | Anti TSPAN15 pAb (ATL-HPA071160) Datasheet (External Link) |
| Vendor Page | Anti TSPAN15 pAb (ATL-HPA071160) |