Anti TSPAN11 pAb (ATL-HPA066789)

Atlas Antibodies

Catalog No.:
ATL-HPA066789-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tetraspanin 11
Gene Name: TSPAN11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030351: 84%, ENSRNOG00000054360: 84%
Entrez Gene ID: 441631
Uniprot ID: A1L157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLSDELKQHLNRTLAENYGQPGATQITASVDRLQQDFKCCGSN
Gene Sequence RLSDELKQHLNRTLAENYGQPGATQITASVDRLQQDFKCCGSN
Gene ID - Mouse ENSMUSG00000030351
Gene ID - Rat ENSRNOG00000054360
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSPAN11 pAb (ATL-HPA066789)
Datasheet Anti TSPAN11 pAb (ATL-HPA066789) Datasheet (External Link)
Vendor Page Anti TSPAN11 pAb (ATL-HPA066789) at Atlas Antibodies

Documents & Links for Anti TSPAN11 pAb (ATL-HPA066789)
Datasheet Anti TSPAN11 pAb (ATL-HPA066789) Datasheet (External Link)
Vendor Page Anti TSPAN11 pAb (ATL-HPA066789)