Anti TSPAN11 pAb (ATL-HPA066789)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066789-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TSPAN11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030351: 84%, ENSRNOG00000054360: 84%
Entrez Gene ID: 441631
Uniprot ID: A1L157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLSDELKQHLNRTLAENYGQPGATQITASVDRLQQDFKCCGSN |
| Gene Sequence | RLSDELKQHLNRTLAENYGQPGATQITASVDRLQQDFKCCGSN |
| Gene ID - Mouse | ENSMUSG00000030351 |
| Gene ID - Rat | ENSRNOG00000054360 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TSPAN11 pAb (ATL-HPA066789) | |
| Datasheet | Anti TSPAN11 pAb (ATL-HPA066789) Datasheet (External Link) |
| Vendor Page | Anti TSPAN11 pAb (ATL-HPA066789) at Atlas Antibodies |
| Documents & Links for Anti TSPAN11 pAb (ATL-HPA066789) | |
| Datasheet | Anti TSPAN11 pAb (ATL-HPA066789) Datasheet (External Link) |
| Vendor Page | Anti TSPAN11 pAb (ATL-HPA066789) |