Anti TSN pAb (ATL-HPA059561)

Atlas Antibodies

Catalog No.:
ATL-HPA059561-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: translin
Gene Name: TSN
Alternative Gene Name: BCLF-1, REHF-1, TRSLN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026374: 98%, ENSRNOG00000002319: 98%
Entrez Gene ID: 7247
Uniprot ID: Q15631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGF
Gene Sequence MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGF
Gene ID - Mouse ENSMUSG00000026374
Gene ID - Rat ENSRNOG00000002319
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSN pAb (ATL-HPA059561)
Datasheet Anti TSN pAb (ATL-HPA059561) Datasheet (External Link)
Vendor Page Anti TSN pAb (ATL-HPA059561) at Atlas Antibodies

Documents & Links for Anti TSN pAb (ATL-HPA059561)
Datasheet Anti TSN pAb (ATL-HPA059561) Datasheet (External Link)
Vendor Page Anti TSN pAb (ATL-HPA059561)
Citations for Anti TSN pAb (ATL-HPA059561) – 1 Found
Geiger, Roger; Rieckmann, Jan C; Wolf, Tobias; Basso, Camilla; Feng, Yuehan; Fuhrer, Tobias; Kogadeeva, Maria; Picotti, Paola; Meissner, Felix; Mann, Matthias; Zamboni, Nicola; Sallusto, Federica; Lanzavecchia, Antonio. L-Arginine Modulates T Cell Metabolism and Enhances Survival and Anti-tumor Activity. Cell. 2016;167(3):829-842.e13.  PubMed