Anti TSN pAb (ATL-HPA059561)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059561-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: TSN
Alternative Gene Name: BCLF-1, REHF-1, TRSLN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026374: 98%, ENSRNOG00000002319: 98%
Entrez Gene ID: 7247
Uniprot ID: Q15631
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGF |
| Gene Sequence | MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGF |
| Gene ID - Mouse | ENSMUSG00000026374 |
| Gene ID - Rat | ENSRNOG00000002319 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TSN pAb (ATL-HPA059561) | |
| Datasheet | Anti TSN pAb (ATL-HPA059561) Datasheet (External Link) |
| Vendor Page | Anti TSN pAb (ATL-HPA059561) at Atlas Antibodies |
| Documents & Links for Anti TSN pAb (ATL-HPA059561) | |
| Datasheet | Anti TSN pAb (ATL-HPA059561) Datasheet (External Link) |
| Vendor Page | Anti TSN pAb (ATL-HPA059561) |
| Citations for Anti TSN pAb (ATL-HPA059561) – 1 Found |
| Geiger, Roger; Rieckmann, Jan C; Wolf, Tobias; Basso, Camilla; Feng, Yuehan; Fuhrer, Tobias; Kogadeeva, Maria; Picotti, Paola; Meissner, Felix; Mann, Matthias; Zamboni, Nicola; Sallusto, Federica; Lanzavecchia, Antonio. L-Arginine Modulates T Cell Metabolism and Enhances Survival and Anti-tumor Activity. Cell. 2016;167(3):829-842.e13. PubMed |