Anti TSHZ3 pAb (ATL-HPA071010)

Atlas Antibodies

Catalog No.:
ATL-HPA071010-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: teashirt zinc finger homeobox 3
Gene Name: TSHZ3
Alternative Gene Name: KIAA1474, TSH3, ZNF537
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021217: 86%, ENSRNOG00000013938: 86%
Entrez Gene ID: 57616
Uniprot ID: Q63HK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQNSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETKEVTVPLED
Gene Sequence VDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQNSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETKEVTVPLED
Gene ID - Mouse ENSMUSG00000021217
Gene ID - Rat ENSRNOG00000013938
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSHZ3 pAb (ATL-HPA071010)
Datasheet Anti TSHZ3 pAb (ATL-HPA071010) Datasheet (External Link)
Vendor Page Anti TSHZ3 pAb (ATL-HPA071010) at Atlas Antibodies

Documents & Links for Anti TSHZ3 pAb (ATL-HPA071010)
Datasheet Anti TSHZ3 pAb (ATL-HPA071010) Datasheet (External Link)
Vendor Page Anti TSHZ3 pAb (ATL-HPA071010)