Anti TSHZ3 pAb (ATL-HPA071010)

Atlas Antibodies

SKU: ATL-HPA071010-25

• 

Protein Description: teashirt zinc finger homeobox 3
Gene Name: TSHZ3
Alternative Gene Name: KIAA1474, TSH3, ZNF537
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021217: 86%, ENSRNOG00000013938: 86%
Entrez Gene ID: 57616
Uniprot ID: Q63HK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQNSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETKEVTVPLED
• Gene Sequence: VDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQNSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETKEVTVPLED
• Gene ID - Mouse: ENSMUSG00000021217
• Gene ID - Rat: ENSRNOG00000013938
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.