Anti TSGA13 pAb (ATL-HPA022968)

Atlas Antibodies

Catalog No.:
ATL-HPA022968-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: testis specific, 13
Gene Name: TSGA13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039032: 53%, ENSRNOG00000011108: 54%
Entrez Gene ID: 114960
Uniprot ID: Q96PP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSQKRQTKFQNGKSKTSENSSAKREKGMVVNSKEISDAVGQSKFVLENLRHYTVHPNLAQYYKPLKATALQKFLAQN
Gene Sequence MSQKRQTKFQNGKSKTSENSSAKREKGMVVNSKEISDAVGQSKFVLENLRHYTVHPNLAQYYKPLKATALQKFLAQN
Gene ID - Mouse ENSMUSG00000039032
Gene ID - Rat ENSRNOG00000011108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSGA13 pAb (ATL-HPA022968)
Datasheet Anti TSGA13 pAb (ATL-HPA022968) Datasheet (External Link)
Vendor Page Anti TSGA13 pAb (ATL-HPA022968) at Atlas Antibodies

Documents & Links for Anti TSGA13 pAb (ATL-HPA022968)
Datasheet Anti TSGA13 pAb (ATL-HPA022968) Datasheet (External Link)
Vendor Page Anti TSGA13 pAb (ATL-HPA022968)