Anti TSEN2 pAb (ATL-HPA027120)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027120-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TSEN2
Alternative Gene Name: MGC2776, SEN2, SEN2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042389: 79%, ENSRNOG00000060175: 79%
Entrez Gene ID: 80746
Uniprot ID: Q8NCE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGILSRSRPSFTISDPKLVAKWKD |
| Gene Sequence | VFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGILSRSRPSFTISDPKLVAKWKD |
| Gene ID - Mouse | ENSMUSG00000042389 |
| Gene ID - Rat | ENSRNOG00000060175 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TSEN2 pAb (ATL-HPA027120) | |
| Datasheet | Anti TSEN2 pAb (ATL-HPA027120) Datasheet (External Link) |
| Vendor Page | Anti TSEN2 pAb (ATL-HPA027120) at Atlas Antibodies |
| Documents & Links for Anti TSEN2 pAb (ATL-HPA027120) | |
| Datasheet | Anti TSEN2 pAb (ATL-HPA027120) Datasheet (External Link) |
| Vendor Page | Anti TSEN2 pAb (ATL-HPA027120) |