Anti TSEN2 pAb (ATL-HPA027120)

Atlas Antibodies

Catalog No.:
ATL-HPA027120-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TSEN2 tRNA splicing endonuclease subunit
Gene Name: TSEN2
Alternative Gene Name: MGC2776, SEN2, SEN2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042389: 79%, ENSRNOG00000060175: 79%
Entrez Gene ID: 80746
Uniprot ID: Q8NCE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGILSRSRPSFTISDPKLVAKWKD
Gene Sequence VFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGILSRSRPSFTISDPKLVAKWKD
Gene ID - Mouse ENSMUSG00000042389
Gene ID - Rat ENSRNOG00000060175
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSEN2 pAb (ATL-HPA027120)
Datasheet Anti TSEN2 pAb (ATL-HPA027120) Datasheet (External Link)
Vendor Page Anti TSEN2 pAb (ATL-HPA027120) at Atlas Antibodies

Documents & Links for Anti TSEN2 pAb (ATL-HPA027120)
Datasheet Anti TSEN2 pAb (ATL-HPA027120) Datasheet (External Link)
Vendor Page Anti TSEN2 pAb (ATL-HPA027120)