Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029237-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TSEN15
Alternative Gene Name: C1orf19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014980: 84%, ENSRNOG00000002352: 84%
Entrez Gene ID: 116461
Uniprot ID: Q8WW01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EERGDSEPTPGCSGLGPDGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATHVYVAFLVYLDLMESK |
| Gene Sequence | EERGDSEPTPGCSGLGPDGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATHVYVAFLVYLDLMESK |
| Gene ID - Mouse | ENSMUSG00000014980 |
| Gene ID - Rat | ENSRNOG00000002352 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) | |
| Datasheet | Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) | |
| Datasheet | Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) |
| Citations for Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) – 1 Found |
| Sekulovski, Samoil; Devant, Pascal; Panizza, Silvia; Gogakos, Tasos; Pitiriciu, Anda; Heitmeier, Katharina; Ramsay, Ewan Phillip; Barth, Marie; Schmidt, Carla; Tuschl, Thomas; Baas, Frank; Weitzer, Stefan; Martinez, Javier; Trowitzsch, Simon. Assembly defects of human tRNA splicing endonuclease contribute to impaired pre-tRNA processing in pontocerebellar hypoplasia. Nature Communications. 2021;12(1):5610. PubMed |