Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029237-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: TSEN15 tRNA splicing endonuclease subunit
Gene Name: TSEN15
Alternative Gene Name: C1orf19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014980: 84%, ENSRNOG00000002352: 84%
Entrez Gene ID: 116461
Uniprot ID: Q8WW01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EERGDSEPTPGCSGLGPDGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATHVYVAFLVYLDLMESK
Gene Sequence EERGDSEPTPGCSGLGPDGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATHVYVAFLVYLDLMESK
Gene ID - Mouse ENSMUSG00000014980
Gene ID - Rat ENSRNOG00000002352
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation)
Datasheet Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation)
Datasheet Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation)
Citations for Anti TSEN15 pAb (ATL-HPA029237 w/enhanced validation) – 1 Found
Sekulovski, Samoil; Devant, Pascal; Panizza, Silvia; Gogakos, Tasos; Pitiriciu, Anda; Heitmeier, Katharina; Ramsay, Ewan Phillip; Barth, Marie; Schmidt, Carla; Tuschl, Thomas; Baas, Frank; Weitzer, Stefan; Martinez, Javier; Trowitzsch, Simon. Assembly defects of human tRNA splicing endonuclease contribute to impaired pre-tRNA processing in pontocerebellar hypoplasia. Nature Communications. 2021;12(1):5610.  PubMed