Anti TSACC pAb (ATL-HPA029897 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029897-25

Protein Description: TSSK6 activating co-chaperone
Gene Name: TSACC
Alternative Gene Name: C1orf182, SIP, SSTK-IP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010538: 52%, ENSRNOG00000037552: 71%
Entrez Gene ID: 128229
Uniprot ID: Q96A04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLG
• Gene Sequence: MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLG
• Gene ID - Mouse: ENSMUSG00000010538
• Gene ID - Rat: ENSRNOG00000037552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.