Anti TRPV3 pAb (ATL-HPA069550)

Atlas Antibodies

Catalog No.:
ATL-HPA069550-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transient receptor potential cation channel, subfamily V, member 3
Gene Name: TRPV3
Alternative Gene Name: VRL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043029: 89%, ENSRNOG00000019606: 89%
Entrez Gene ID: 162514
Uniprot ID: Q8NET8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETS
Gene Sequence EFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETS
Gene ID - Mouse ENSMUSG00000043029
Gene ID - Rat ENSRNOG00000019606
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRPV3 pAb (ATL-HPA069550)
Datasheet Anti TRPV3 pAb (ATL-HPA069550) Datasheet (External Link)
Vendor Page Anti TRPV3 pAb (ATL-HPA069550) at Atlas Antibodies

Documents & Links for Anti TRPV3 pAb (ATL-HPA069550)
Datasheet Anti TRPV3 pAb (ATL-HPA069550) Datasheet (External Link)
Vendor Page Anti TRPV3 pAb (ATL-HPA069550)