Anti TRPS1 pAb (ATL-HPA060380)

Atlas Antibodies

Catalog No.:
ATL-HPA060380-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: trichorhinophalangeal syndrome I
Gene Name: TRPS1
Alternative Gene Name: GC79, LGCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038679: 99%, ENSRNOG00000024998: 99%
Entrez Gene ID: 7227
Uniprot ID: Q9UHF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGP
Gene Sequence SPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGP
Gene ID - Mouse ENSMUSG00000038679
Gene ID - Rat ENSRNOG00000024998
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRPS1 pAb (ATL-HPA060380)
Datasheet Anti TRPS1 pAb (ATL-HPA060380) Datasheet (External Link)
Vendor Page Anti TRPS1 pAb (ATL-HPA060380) at Atlas Antibodies

Documents & Links for Anti TRPS1 pAb (ATL-HPA060380)
Datasheet Anti TRPS1 pAb (ATL-HPA060380) Datasheet (External Link)
Vendor Page Anti TRPS1 pAb (ATL-HPA060380)