Anti TRPM1 pAb (ATL-HPA071139)

Atlas Antibodies

Catalog No.:
ATL-HPA071139-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transient receptor potential cation channel subfamily M member 1
Gene Name: TRPM1
Alternative Gene Name: CSNB1C, LTRPC1, MLSN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030523: 41%, ENSRNOG00000015829: 42%
Entrez Gene ID: 4308
Uniprot ID: Q7Z4N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NAEESKLGPDIGISKEDDERQTDSKKEETISPSLNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSFVYSR
Gene Sequence NAEESKLGPDIGISKEDDERQTDSKKEETISPSLNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSFVYSR
Gene ID - Mouse ENSMUSG00000030523
Gene ID - Rat ENSRNOG00000015829
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRPM1 pAb (ATL-HPA071139)
Datasheet Anti TRPM1 pAb (ATL-HPA071139) Datasheet (External Link)
Vendor Page Anti TRPM1 pAb (ATL-HPA071139) at Atlas Antibodies

Documents & Links for Anti TRPM1 pAb (ATL-HPA071139)
Datasheet Anti TRPM1 pAb (ATL-HPA071139) Datasheet (External Link)
Vendor Page Anti TRPM1 pAb (ATL-HPA071139)