Anti TRPM1 pAb (ATL-HPA071139)

Atlas Antibodies

Catalog No.: ATL-HPA071139-25

Protein Description: transient receptor potential cation channel subfamily M member 1
Gene Name: TRPM1
Alternative Gene Name: CSNB1C, LTRPC1, MLSN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030523: 41%, ENSRNOG00000015829: 42%
Entrez Gene ID: 4308
Uniprot ID: Q7Z4N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NAEESKLGPDIGISKEDDERQTDSKKEETISPSLNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSFVYSR
• Gene Sequence: NAEESKLGPDIGISKEDDERQTDSKKEETISPSLNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSFVYSR
• Gene ID - Mouse: ENSMUSG00000030523
• Gene ID - Rat: ENSRNOG00000015829
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.