Anti TRPM1 pAb (ATL-HPA014779)

Atlas Antibodies

Catalog No.: ATL-HPA014779-25

Protein Description: transient receptor potential cation channel, subfamily M, member 1
Gene Name: TRPM1
Alternative Gene Name: CSNB1C, LTRPC1, MLSN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030523: 61%, ENSRNOG00000015829: 65%
Entrez Gene ID: 4308
Uniprot ID: Q7Z4N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CEATYLLRQSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPECQNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDD
• Gene Sequence: CEATYLLRQSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPECQNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDD
• Gene ID - Mouse: ENSMUSG00000030523
• Gene ID - Rat: ENSRNOG00000015829
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRPM1 pAb (ATL-HPA014779) – 1 Found

Cowan, Cameron S; Renner, Magdalena; De Gennaro, Martina; Gross-Scherf, Brigitte; Goldblum, David; Hou, Yanyan; Munz, Martin; Rodrigues, Tiago M; Krol, Jacek; Szikra, Tamas; Cuttat, Rachel; Waldt, Annick; Papasaikas, Panagiotis; Diggelmann, Roland; Patino-Alvarez, Claudia P; Galliker, Patricia; Spirig, Stefan E; Pavlinic, Dinko; Gerber-Hollbach, Nadine; Schuierer, Sven; Srdanovic, Aldin; Balogh, Marton; Panero, Riccardo; Kusnyerik, Akos; Szabo, Arnold; Stadler, Michael B; Orgül, Selim; Picelli, Simone; Hasler, Pascal W; Hierlemann, Andreas; Scholl, Hendrik P N; Roma, Guglielmo; Nigsch, Florian; Roska, Botond. Cell Types of the Human Retina and Its Organoids at Single-Cell Resolution. Cell. 2020;182(6):1623-1640.e34.