Anti TRPC6 pAb (ATL-HPA062164)

Atlas Antibodies

SKU: ATL-HPA062164-25

• 

Protein Description: transient receptor potential cation channel, subfamily C, member 6
Gene Name: TRPC6
Alternative Gene Name: FSGS2, TRP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031997: 100%, ENSRNOG00000006324: 100%
Entrez Gene ID: 7225
Uniprot ID: Q9Y210
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWD
• Gene Sequence: WHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWD
• Gene ID - Mouse: ENSMUSG00000031997
• Gene ID - Rat: ENSRNOG00000006324
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.