Anti TRPC6 pAb (ATL-HPA062164)

Atlas Antibodies

Catalog No.:
ATL-HPA062164-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: transient receptor potential cation channel, subfamily C, member 6
Gene Name: TRPC6
Alternative Gene Name: FSGS2, TRP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031997: 100%, ENSRNOG00000006324: 100%
Entrez Gene ID: 7225
Uniprot ID: Q9Y210
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWD
Gene Sequence WHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWD
Gene ID - Mouse ENSMUSG00000031997
Gene ID - Rat ENSRNOG00000006324
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRPC6 pAb (ATL-HPA062164)
Datasheet Anti TRPC6 pAb (ATL-HPA062164) Datasheet (External Link)
Vendor Page Anti TRPC6 pAb (ATL-HPA062164) at Atlas Antibodies

Documents & Links for Anti TRPC6 pAb (ATL-HPA062164)
Datasheet Anti TRPC6 pAb (ATL-HPA062164) Datasheet (External Link)
Vendor Page Anti TRPC6 pAb (ATL-HPA062164)