Anti TRPC4AP pAb (ATL-HPA065061)

Atlas Antibodies

Catalog No.:
ATL-HPA065061-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transient receptor potential cation channel, subfamily C, member 4 associated protein
Gene Name: TRPC4AP
Alternative Gene Name: C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, PPP1R158, TRRP4AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038324: 100%, ENSRNOG00000019152: 100%
Entrez Gene ID: 26133
Uniprot ID: Q8TEL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINS
Gene Sequence ESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINS
Gene ID - Mouse ENSMUSG00000038324
Gene ID - Rat ENSRNOG00000019152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRPC4AP pAb (ATL-HPA065061)
Datasheet Anti TRPC4AP pAb (ATL-HPA065061) Datasheet (External Link)
Vendor Page Anti TRPC4AP pAb (ATL-HPA065061) at Atlas Antibodies

Documents & Links for Anti TRPC4AP pAb (ATL-HPA065061)
Datasheet Anti TRPC4AP pAb (ATL-HPA065061) Datasheet (External Link)
Vendor Page Anti TRPC4AP pAb (ATL-HPA065061)