Anti TRMU pAb (ATL-HPA043300)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043300-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TRMU
Alternative Gene Name: FLJ10140, MTO2, TRMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022386: 94%, ENSRNOG00000016465: 93%
Entrez Gene ID: 55687
Uniprot ID: O75648
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVS |
| Gene Sequence | AVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVS |
| Gene ID - Mouse | ENSMUSG00000022386 |
| Gene ID - Rat | ENSRNOG00000016465 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TRMU pAb (ATL-HPA043300) | |
| Datasheet | Anti TRMU pAb (ATL-HPA043300) Datasheet (External Link) |
| Vendor Page | Anti TRMU pAb (ATL-HPA043300) at Atlas Antibodies |
| Documents & Links for Anti TRMU pAb (ATL-HPA043300) | |
| Datasheet | Anti TRMU pAb (ATL-HPA043300) Datasheet (External Link) |
| Vendor Page | Anti TRMU pAb (ATL-HPA043300) |