Anti TRMU pAb (ATL-HPA043300)

Atlas Antibodies

Catalog No.:
ATL-HPA043300-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
Gene Name: TRMU
Alternative Gene Name: FLJ10140, MTO2, TRMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022386: 94%, ENSRNOG00000016465: 93%
Entrez Gene ID: 55687
Uniprot ID: O75648
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVS
Gene Sequence AVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVS
Gene ID - Mouse ENSMUSG00000022386
Gene ID - Rat ENSRNOG00000016465
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRMU pAb (ATL-HPA043300)
Datasheet Anti TRMU pAb (ATL-HPA043300) Datasheet (External Link)
Vendor Page Anti TRMU pAb (ATL-HPA043300) at Atlas Antibodies

Documents & Links for Anti TRMU pAb (ATL-HPA043300)
Datasheet Anti TRMU pAb (ATL-HPA043300) Datasheet (External Link)
Vendor Page Anti TRMU pAb (ATL-HPA043300)