Anti TRMT6 pAb (ATL-HPA050408)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050408-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TRMT6
Alternative Gene Name: CGI-09, GCD10, Gcd10p, MGC5029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037376: 97%, ENSRNOG00000021270: 98%
Entrez Gene ID: 51605
Uniprot ID: Q9UJA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LKDKGIKGEEIVQQLIENSTTFRDKTEFAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAGN |
| Gene Sequence | LKDKGIKGEEIVQQLIENSTTFRDKTEFAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAGN |
| Gene ID - Mouse | ENSMUSG00000037376 |
| Gene ID - Rat | ENSRNOG00000021270 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TRMT6 pAb (ATL-HPA050408) | |
| Datasheet | Anti TRMT6 pAb (ATL-HPA050408) Datasheet (External Link) |
| Vendor Page | Anti TRMT6 pAb (ATL-HPA050408) at Atlas Antibodies |
| Documents & Links for Anti TRMT6 pAb (ATL-HPA050408) | |
| Datasheet | Anti TRMT6 pAb (ATL-HPA050408) Datasheet (External Link) |
| Vendor Page | Anti TRMT6 pAb (ATL-HPA050408) |