Anti TRMT11 pAb (ATL-HPA030473)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030473-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TRMT11
Alternative Gene Name: C6orf75, dJ187J11.2, MDS024, TRM11, TRMT11-1
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 60487
Uniprot ID: Q7Z4G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGG |
| Gene Sequence | FSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGG |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TRMT11 pAb (ATL-HPA030473) | |
| Datasheet | Anti TRMT11 pAb (ATL-HPA030473) Datasheet (External Link) |
| Vendor Page | Anti TRMT11 pAb (ATL-HPA030473) at Atlas Antibodies |
| Documents & Links for Anti TRMT11 pAb (ATL-HPA030473) | |
| Datasheet | Anti TRMT11 pAb (ATL-HPA030473) Datasheet (External Link) |
| Vendor Page | Anti TRMT11 pAb (ATL-HPA030473) |