Anti TRMT11 pAb (ATL-HPA030473)

Atlas Antibodies

Catalog No.:
ATL-HPA030473-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tRNA methyltransferase 11 homolog
Gene Name: TRMT11
Alternative Gene Name: C6orf75, dJ187J11.2, MDS024, TRM11, TRMT11-1
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 60487
Uniprot ID: Q7Z4G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGG
Gene Sequence FSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGG
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRMT11 pAb (ATL-HPA030473)
Datasheet Anti TRMT11 pAb (ATL-HPA030473) Datasheet (External Link)
Vendor Page Anti TRMT11 pAb (ATL-HPA030473) at Atlas Antibodies

Documents & Links for Anti TRMT11 pAb (ATL-HPA030473)
Datasheet Anti TRMT11 pAb (ATL-HPA030473) Datasheet (External Link)
Vendor Page Anti TRMT11 pAb (ATL-HPA030473)