Anti TRIP10 pAb (ATL-HPA072625)

Atlas Antibodies

Catalog No.:
ATL-HPA072625-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: thyroid hormone receptor interactor 10
Gene Name: TRIP10
Alternative Gene Name: CIP4, HSTP, STOT, STP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019487: 86%, ENSRNOG00000055524: 86%
Entrez Gene ID: 9322
Uniprot ID: Q15642
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDPPASAPPDSSSNSASQDTKESSEE
Gene Sequence QIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDPPASAPPDSSSNSASQDTKESSEE
Gene ID - Mouse ENSMUSG00000019487
Gene ID - Rat ENSRNOG00000055524
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIP10 pAb (ATL-HPA072625)
Datasheet Anti TRIP10 pAb (ATL-HPA072625) Datasheet (External Link)
Vendor Page Anti TRIP10 pAb (ATL-HPA072625) at Atlas Antibodies

Documents & Links for Anti TRIP10 pAb (ATL-HPA072625)
Datasheet Anti TRIP10 pAb (ATL-HPA072625) Datasheet (External Link)
Vendor Page Anti TRIP10 pAb (ATL-HPA072625)