Anti TRIM8 pAb (ATL-HPA023561)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023561-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TRIM8
Alternative Gene Name: GERP, RNF27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025034: 99%, ENSRNOG00000019968: 99%
Entrez Gene ID: 81603
Uniprot ID: Q9BZR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGS |
| Gene Sequence | QDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGS |
| Gene ID - Mouse | ENSMUSG00000025034 |
| Gene ID - Rat | ENSRNOG00000019968 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TRIM8 pAb (ATL-HPA023561) | |
| Datasheet | Anti TRIM8 pAb (ATL-HPA023561) Datasheet (External Link) |
| Vendor Page | Anti TRIM8 pAb (ATL-HPA023561) at Atlas Antibodies |
| Documents & Links for Anti TRIM8 pAb (ATL-HPA023561) | |
| Datasheet | Anti TRIM8 pAb (ATL-HPA023561) Datasheet (External Link) |
| Vendor Page | Anti TRIM8 pAb (ATL-HPA023561) |
| Citations for Anti TRIM8 pAb (ATL-HPA023561) – 1 Found |
| Tian, Zelin; Tang, Jianing; Liao, Xing; Gong, Yan; Yang, Qian; Wu, Yumin; Wu, Gaosong. TRIM8 inhibits breast cancer proliferation by regulating estrogen signaling. American Journal Of Cancer Research. 10(10):3440-3457. PubMed |