Anti TRIM8 pAb (ATL-HPA023561)

Atlas Antibodies

Catalog No.: ATL-HPA023561-25

Protein Description: tripartite motif containing 8
Gene Name: TRIM8
Alternative Gene Name: GERP, RNF27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025034: 99%, ENSRNOG00000019968: 99%
Entrez Gene ID: 81603
Uniprot ID: Q9BZR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGS
• Gene Sequence: QDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGS
• Gene ID - Mouse: ENSMUSG00000025034
• Gene ID - Rat: ENSRNOG00000019968
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIM8 pAb (ATL-HPA023561) – 1 Found

Tian, Zelin; Tang, Jianing; Liao, Xing; Gong, Yan; Yang, Qian; Wu, Yumin; Wu, Gaosong. TRIM8 inhibits breast cancer proliferation by regulating estrogen signaling. American Journal Of Cancer Research. 10(10):3440-3457.