Anti TRIM68 pAb (ATL-HPA023455)

Atlas Antibodies

Catalog No.: ATL-HPA023455-25

Protein Description: tripartite motif containing 68
Gene Name: TRIM68
Alternative Gene Name: FLJ10369, RNF137, SS-56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073968: 79%, ENSRNOG00000047229: 82%
Entrez Gene ID: 55128
Uniprot ID: Q6AZZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEPISLELKTDCRVLG
• Gene Sequence: KLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEPISLELKTDCRVLG
• Gene ID - Mouse: ENSMUSG00000073968
• Gene ID - Rat: ENSRNOG00000047229
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.