Anti TRIM65 pAb (ATL-HPA064820)

Atlas Antibodies

Catalog No.:
ATL-HPA064820-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 65
Gene Name: TRIM65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054517: 51%, ENSRNOG00000024145: 47%
Entrez Gene ID: 201292
Uniprot ID: Q6PJ69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IEVAKTQALAQARDEEQRLRVHLEAVARHGCRIRELLEQVDEQTFLQESQLLQPPGPLGPLTPLQWDEDQQLGDLKQLLSRLCGLLLEEGSHPGAPAKPVDLA
Gene Sequence IEVAKTQALAQARDEEQRLRVHLEAVARHGCRIRELLEQVDEQTFLQESQLLQPPGPLGPLTPLQWDEDQQLGDLKQLLSRLCGLLLEEGSHPGAPAKPVDLA
Gene ID - Mouse ENSMUSG00000054517
Gene ID - Rat ENSRNOG00000024145
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM65 pAb (ATL-HPA064820)
Datasheet Anti TRIM65 pAb (ATL-HPA064820) Datasheet (External Link)
Vendor Page Anti TRIM65 pAb (ATL-HPA064820) at Atlas Antibodies

Documents & Links for Anti TRIM65 pAb (ATL-HPA064820)
Datasheet Anti TRIM65 pAb (ATL-HPA064820) Datasheet (External Link)
Vendor Page Anti TRIM65 pAb (ATL-HPA064820)