Anti TRIM61 pAb (ATL-HPA049109)

Atlas Antibodies

Catalog No.: ATL-HPA049109-25

Protein Description: tripartite motif containing 61
Gene Name: TRIM61
Alternative Gene Name: RNF35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109718: 38%, ENSRNOG00000015148: 36%
Entrez Gene ID: 391712
Uniprot ID: Q5EBN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLEEYNAPWKERVELIEKVITMQTRKSLELKKKMESPSV
• Gene Sequence: KLEEYNAPWKERVELIEKVITMQTRKSLELKKKMESPSV
• Gene ID - Mouse: ENSMUSG00000109718
• Gene ID - Rat: ENSRNOG00000015148
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.