Anti TRIM61 pAb (ATL-HPA049109)

Atlas Antibodies

Catalog No.:
ATL-HPA049109-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 61
Gene Name: TRIM61
Alternative Gene Name: RNF35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109718: 38%, ENSRNOG00000015148: 36%
Entrez Gene ID: 391712
Uniprot ID: Q5EBN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLEEYNAPWKERVELIEKVITMQTRKSLELKKKMESPSV
Gene Sequence KLEEYNAPWKERVELIEKVITMQTRKSLELKKKMESPSV
Gene ID - Mouse ENSMUSG00000109718
Gene ID - Rat ENSRNOG00000015148
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM61 pAb (ATL-HPA049109)
Datasheet Anti TRIM61 pAb (ATL-HPA049109) Datasheet (External Link)
Vendor Page Anti TRIM61 pAb (ATL-HPA049109) at Atlas Antibodies

Documents & Links for Anti TRIM61 pAb (ATL-HPA049109)
Datasheet Anti TRIM61 pAb (ATL-HPA049109) Datasheet (External Link)
Vendor Page Anti TRIM61 pAb (ATL-HPA049109)