Anti TRIM6 pAb (ATL-HPA060514)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060514-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TRIM6
Alternative Gene Name: RNF89
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072244: 88%, ENSRNOG00000017147: 89%
Entrez Gene ID: 117854
Uniprot ID: Q9C030
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFS |
Gene Sequence | VQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFS |
Gene ID - Mouse | ENSMUSG00000072244 |
Gene ID - Rat | ENSRNOG00000017147 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TRIM6 pAb (ATL-HPA060514) | |
Datasheet | Anti TRIM6 pAb (ATL-HPA060514) Datasheet (External Link) |
Vendor Page | Anti TRIM6 pAb (ATL-HPA060514) at Atlas Antibodies |
Documents & Links for Anti TRIM6 pAb (ATL-HPA060514) | |
Datasheet | Anti TRIM6 pAb (ATL-HPA060514) Datasheet (External Link) |
Vendor Page | Anti TRIM6 pAb (ATL-HPA060514) |