Anti TRIM6 pAb (ATL-HPA060514)

Atlas Antibodies

Catalog No.:
ATL-HPA060514-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 6
Gene Name: TRIM6
Alternative Gene Name: RNF89
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072244: 88%, ENSRNOG00000017147: 89%
Entrez Gene ID: 117854
Uniprot ID: Q9C030
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFS
Gene Sequence VQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFS
Gene ID - Mouse ENSMUSG00000072244
Gene ID - Rat ENSRNOG00000017147
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM6 pAb (ATL-HPA060514)
Datasheet Anti TRIM6 pAb (ATL-HPA060514) Datasheet (External Link)
Vendor Page Anti TRIM6 pAb (ATL-HPA060514) at Atlas Antibodies

Documents & Links for Anti TRIM6 pAb (ATL-HPA060514)
Datasheet Anti TRIM6 pAb (ATL-HPA060514) Datasheet (External Link)
Vendor Page Anti TRIM6 pAb (ATL-HPA060514)