Anti TRIM6 pAb (ATL-HPA060514)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060514-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TRIM6
Alternative Gene Name: RNF89
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072244: 88%, ENSRNOG00000017147: 89%
Entrez Gene ID: 117854
Uniprot ID: Q9C030
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFS |
| Gene Sequence | VQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFS |
| Gene ID - Mouse | ENSMUSG00000072244 |
| Gene ID - Rat | ENSRNOG00000017147 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TRIM6 pAb (ATL-HPA060514) | |
| Datasheet | Anti TRIM6 pAb (ATL-HPA060514) Datasheet (External Link) |
| Vendor Page | Anti TRIM6 pAb (ATL-HPA060514) at Atlas Antibodies |
| Documents & Links for Anti TRIM6 pAb (ATL-HPA060514) | |
| Datasheet | Anti TRIM6 pAb (ATL-HPA060514) Datasheet (External Link) |
| Vendor Page | Anti TRIM6 pAb (ATL-HPA060514) |