Anti TRIM54 pAb (ATL-HPA019690)

Atlas Antibodies

Catalog No.: ATL-HPA019690-25

Protein Description: tripartite motif containing 54
Gene Name: TRIM54
Alternative Gene Name: MURF, MURF-3, RNF30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062077: 85%, ENSRNOG00000006146: 88%
Entrez Gene ID: 57159
Uniprot ID: Q9BYV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDG
• Gene Sequence: MEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDG
• Gene ID - Mouse: ENSMUSG00000062077
• Gene ID - Rat: ENSRNOG00000006146
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.