Anti TRIM52 pAb (ATL-HPA054565)

Atlas Antibodies

Catalog No.:
ATL-HPA054565-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 52
Gene Name: TRIM52
Alternative Gene Name: RNF102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040365: 45%, ENSRNOG00000002388: 43%
Entrez Gene ID: 84851
Uniprot ID: Q96A61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEE
Gene Sequence EDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEE
Gene ID - Mouse ENSMUSG00000040365
Gene ID - Rat ENSRNOG00000002388
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM52 pAb (ATL-HPA054565)
Datasheet Anti TRIM52 pAb (ATL-HPA054565) Datasheet (External Link)
Vendor Page Anti TRIM52 pAb (ATL-HPA054565) at Atlas Antibodies

Documents & Links for Anti TRIM52 pAb (ATL-HPA054565)
Datasheet Anti TRIM52 pAb (ATL-HPA054565) Datasheet (External Link)
Vendor Page Anti TRIM52 pAb (ATL-HPA054565)