Anti TRIM52 pAb (ATL-HPA054565)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054565-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TRIM52
Alternative Gene Name: RNF102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040365: 45%, ENSRNOG00000002388: 43%
Entrez Gene ID: 84851
Uniprot ID: Q96A61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEE |
Gene Sequence | EDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEE |
Gene ID - Mouse | ENSMUSG00000040365 |
Gene ID - Rat | ENSRNOG00000002388 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TRIM52 pAb (ATL-HPA054565) | |
Datasheet | Anti TRIM52 pAb (ATL-HPA054565) Datasheet (External Link) |
Vendor Page | Anti TRIM52 pAb (ATL-HPA054565) at Atlas Antibodies |
Documents & Links for Anti TRIM52 pAb (ATL-HPA054565) | |
Datasheet | Anti TRIM52 pAb (ATL-HPA054565) Datasheet (External Link) |
Vendor Page | Anti TRIM52 pAb (ATL-HPA054565) |