Anti TRIM50 pAb (ATL-HPA019862)

Atlas Antibodies

Catalog No.: ATL-HPA019862-25

Protein Description: tripartite motif containing 50
Gene Name: TRIM50
Alternative Gene Name: FLJ32804, TRIM50A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053388: 93%, ENSRNOG00000022483: 95%
Entrez Gene ID: 135892
Uniprot ID: Q86XT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTC
• Gene Sequence: AFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDPATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTC
• Gene ID - Mouse: ENSMUSG00000053388
• Gene ID - Rat: ENSRNOG00000022483
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.