Anti TRIM5 pAb (ATL-HPA023422)

Atlas Antibodies

Catalog No.: ATL-HPA023422-25

Protein Description: tripartite motif containing 5
Gene Name: TRIM5
Alternative Gene Name: RNF88, TRIM5alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090215: 46%, ENSRNOG00000042686: 48%
Entrez Gene ID: 85363
Uniprot ID: Q9C035
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLREL
• Gene Sequence: IREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLREL
• Gene ID - Mouse: ENSMUSG00000090215
• Gene ID - Rat: ENSRNOG00000042686
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIM5 pAb (ATL-HPA023422) – 1 Found

Sandler, Netanya G; Bosinger, Steven E; Estes, Jacob D; Zhu, Richard T R; Tharp, Gregory K; Boritz, Eli; Levin, Doron; Wijeyesinghe, Sathi; Makamdop, Krystelle Nganou; del Prete, Gregory Q; Hill, Brenna J; Timmer, J Katherina; Reiss, Emma; Yarden, Ganit; Darko, Samuel; Contijoch, Eduardo; Todd, John Paul; Silvestri, Guido; Nason, Martha; Norgren, Robert B Jr; Keele, Brandon F; Rao, Srinivas; Langer, Jerome A; Lifson, Jeffrey D; Schreiber, Gideon; Douek, Daniel C. Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression. Nature. 2014;511(7511):601-5.