Anti TRIM5 pAb (ATL-HPA023420)

Atlas Antibodies

Catalog No.:
ATL-HPA023420-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 5
Gene Name: TRIM5
Alternative Gene Name: RNF88, TRIM5alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072244: 30%, ENSRNOG00000017191: 36%
Entrez Gene ID: 85363
Uniprot ID: Q9C035
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQS
Gene Sequence KGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQS
Gene ID - Mouse ENSMUSG00000072244
Gene ID - Rat ENSRNOG00000017191
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM5 pAb (ATL-HPA023420)
Datasheet Anti TRIM5 pAb (ATL-HPA023420) Datasheet (External Link)
Vendor Page Anti TRIM5 pAb (ATL-HPA023420) at Atlas Antibodies

Documents & Links for Anti TRIM5 pAb (ATL-HPA023420)
Datasheet Anti TRIM5 pAb (ATL-HPA023420) Datasheet (External Link)
Vendor Page Anti TRIM5 pAb (ATL-HPA023420)