Anti TRIM46 pAb (ATL-HPA030389)

Atlas Antibodies

Catalog No.:
ATL-HPA030389-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 46
Gene Name: TRIM46
Alternative Gene Name: FLJ23229, TRIFIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042766: 97%, ENSRNOG00000055433: 97%
Entrez Gene ID: 80128
Uniprot ID: Q7Z4K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVRHTEVSGQQAKEEVSQLVRGLGAVLEEKR
Gene Sequence MCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVRHTEVSGQQAKEEVSQLVRGLGAVLEEKR
Gene ID - Mouse ENSMUSG00000042766
Gene ID - Rat ENSRNOG00000055433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM46 pAb (ATL-HPA030389)
Datasheet Anti TRIM46 pAb (ATL-HPA030389) Datasheet (External Link)
Vendor Page Anti TRIM46 pAb (ATL-HPA030389) at Atlas Antibodies

Documents & Links for Anti TRIM46 pAb (ATL-HPA030389)
Datasheet Anti TRIM46 pAb (ATL-HPA030389) Datasheet (External Link)
Vendor Page Anti TRIM46 pAb (ATL-HPA030389)