Anti TRIM46 pAb (ATL-HPA030389)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030389-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TRIM46
Alternative Gene Name: FLJ23229, TRIFIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042766: 97%, ENSRNOG00000055433: 97%
Entrez Gene ID: 80128
Uniprot ID: Q7Z4K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVRHTEVSGQQAKEEVSQLVRGLGAVLEEKR |
| Gene Sequence | MCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVRHTEVSGQQAKEEVSQLVRGLGAVLEEKR |
| Gene ID - Mouse | ENSMUSG00000042766 |
| Gene ID - Rat | ENSRNOG00000055433 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TRIM46 pAb (ATL-HPA030389) | |
| Datasheet | Anti TRIM46 pAb (ATL-HPA030389) Datasheet (External Link) |
| Vendor Page | Anti TRIM46 pAb (ATL-HPA030389) at Atlas Antibodies |
| Documents & Links for Anti TRIM46 pAb (ATL-HPA030389) | |
| Datasheet | Anti TRIM46 pAb (ATL-HPA030389) Datasheet (External Link) |
| Vendor Page | Anti TRIM46 pAb (ATL-HPA030389) |