Anti TRIM44 pAb (ATL-HPA057633)

Atlas Antibodies

Catalog No.:
ATL-HPA057633-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 44
Gene Name: TRIM44
Alternative Gene Name: DIPB, MC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027189: 99%, ENSRNOG00000005191: 96%
Entrez Gene ID: 54765
Uniprot ID: Q96DX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGA
Gene Sequence LVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGA
Gene ID - Mouse ENSMUSG00000027189
Gene ID - Rat ENSRNOG00000005191
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM44 pAb (ATL-HPA057633)
Datasheet Anti TRIM44 pAb (ATL-HPA057633) Datasheet (External Link)
Vendor Page Anti TRIM44 pAb (ATL-HPA057633) at Atlas Antibodies

Documents & Links for Anti TRIM44 pAb (ATL-HPA057633)
Datasheet Anti TRIM44 pAb (ATL-HPA057633) Datasheet (External Link)
Vendor Page Anti TRIM44 pAb (ATL-HPA057633)