Anti TRIM44 pAb (ATL-HPA057633)

Atlas Antibodies

Catalog No.: ATL-HPA057633-25

Protein Description: tripartite motif containing 44
Gene Name: TRIM44
Alternative Gene Name: DIPB, MC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027189: 99%, ENSRNOG00000005191: 96%
Entrez Gene ID: 54765
Uniprot ID: Q96DX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGA
• Gene Sequence: LVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGA
• Gene ID - Mouse: ENSMUSG00000027189
• Gene ID - Rat: ENSRNOG00000005191
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.