Anti TRIM44 pAb (ATL-HPA057633)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057633-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TRIM44
Alternative Gene Name: DIPB, MC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027189: 99%, ENSRNOG00000005191: 96%
Entrez Gene ID: 54765
Uniprot ID: Q96DX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGA |
| Gene Sequence | LVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGA |
| Gene ID - Mouse | ENSMUSG00000027189 |
| Gene ID - Rat | ENSRNOG00000005191 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TRIM44 pAb (ATL-HPA057633) | |
| Datasheet | Anti TRIM44 pAb (ATL-HPA057633) Datasheet (External Link) |
| Vendor Page | Anti TRIM44 pAb (ATL-HPA057633) at Atlas Antibodies |
| Documents & Links for Anti TRIM44 pAb (ATL-HPA057633) | |
| Datasheet | Anti TRIM44 pAb (ATL-HPA057633) Datasheet (External Link) |
| Vendor Page | Anti TRIM44 pAb (ATL-HPA057633) |