Anti TRIM39 pAb (ATL-HPA059496)

Atlas Antibodies

Catalog No.:
ATL-HPA059496-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 39
Gene Name: TRIM39
Alternative Gene Name: RNF23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045409: 100%, ENSRNOG00000000785: 100%
Entrez Gene ID: 56658
Uniprot ID: Q9HCM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRV
Gene Sequence SRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRV
Gene ID - Mouse ENSMUSG00000045409
Gene ID - Rat ENSRNOG00000000785
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM39 pAb (ATL-HPA059496)
Datasheet Anti TRIM39 pAb (ATL-HPA059496) Datasheet (External Link)
Vendor Page Anti TRIM39 pAb (ATL-HPA059496) at Atlas Antibodies

Documents & Links for Anti TRIM39 pAb (ATL-HPA059496)
Datasheet Anti TRIM39 pAb (ATL-HPA059496) Datasheet (External Link)
Vendor Page Anti TRIM39 pAb (ATL-HPA059496)