Anti TRIM36 pAb (ATL-HPA061321)

Atlas Antibodies

Catalog No.:
ATL-HPA061321-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 36
Gene Name: TRIM36
Alternative Gene Name: HAPRIN, RBCC728, RNF98
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033949: 94%, ENSRNOG00000016612: 94%
Entrez Gene ID: 55521
Uniprot ID: Q9NQ86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYCELCRRPVCHLCKLGGNHANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEEAITHFEKLFEVL
Gene Sequence MYCELCRRPVCHLCKLGGNHANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEEAITHFEKLFEVL
Gene ID - Mouse ENSMUSG00000033949
Gene ID - Rat ENSRNOG00000016612
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM36 pAb (ATL-HPA061321)
Datasheet Anti TRIM36 pAb (ATL-HPA061321) Datasheet (External Link)
Vendor Page Anti TRIM36 pAb (ATL-HPA061321) at Atlas Antibodies

Documents & Links for Anti TRIM36 pAb (ATL-HPA061321)
Datasheet Anti TRIM36 pAb (ATL-HPA061321) Datasheet (External Link)
Vendor Page Anti TRIM36 pAb (ATL-HPA061321)