Anti TRIM36 pAb (ATL-HPA061321)

Atlas Antibodies

Catalog No.: ATL-HPA061321-25

Protein Description: tripartite motif containing 36
Gene Name: TRIM36
Alternative Gene Name: HAPRIN, RBCC728, RNF98
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033949: 94%, ENSRNOG00000016612: 94%
Entrez Gene ID: 55521
Uniprot ID: Q9NQ86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MYCELCRRPVCHLCKLGGNHANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEEAITHFEKLFEVL
• Gene Sequence: MYCELCRRPVCHLCKLGGNHANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEEAITHFEKLFEVL
• Gene ID - Mouse: ENSMUSG00000033949
• Gene ID - Rat: ENSRNOG00000016612
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.