Anti TRIM35 pAb (ATL-HPA019647)

Atlas Antibodies

Catalog No.: ATL-HPA019647-25

Protein Description: tripartite motif containing 35
Gene Name: TRIM35
Alternative Gene Name: HLS5, KIAA1098, MAIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022043: 77%, ENSRNOG00000009449: 77%
Entrez Gene ID: 23087
Uniprot ID: Q9UPQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDVSFLM
• Gene Sequence: AKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDVSFLM
• Gene ID - Mouse: ENSMUSG00000022043
• Gene ID - Rat: ENSRNOG00000009449
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.