Anti TRIM31 pAb (ATL-HPA074175 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA074175-25

• 

Protein Description: tripartite motif containing 31
Gene Name: TRIM31
Alternative Gene Name: C6orf13, HCG1, HCGI, RNF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058063: 55%, ENSRNOG00000021518: 49%
Entrez Gene ID: 11074
Uniprot ID: Q9BZY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLS
• Gene Sequence: ESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLS
• Gene ID - Mouse: ENSMUSG00000058063
• Gene ID - Rat: ENSRNOG00000021518
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.