Anti TRIM16 pAb (ATL-HPA066431)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066431-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TRIM16
Alternative Gene Name: EBBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047821: 83%, ENSRNOG00000003219: 86%
Entrez Gene ID: 10626
Uniprot ID: O95361
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YCKFKNTEDITFPSVYIGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAIVQRKYWTSKPEPST |
Gene Sequence | YCKFKNTEDITFPSVYIGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAIVQRKYWTSKPEPST |
Gene ID - Mouse | ENSMUSG00000047821 |
Gene ID - Rat | ENSRNOG00000003219 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TRIM16 pAb (ATL-HPA066431) | |
Datasheet | Anti TRIM16 pAb (ATL-HPA066431) Datasheet (External Link) |
Vendor Page | Anti TRIM16 pAb (ATL-HPA066431) at Atlas Antibodies |
Documents & Links for Anti TRIM16 pAb (ATL-HPA066431) | |
Datasheet | Anti TRIM16 pAb (ATL-HPA066431) Datasheet (External Link) |
Vendor Page | Anti TRIM16 pAb (ATL-HPA066431) |