Anti TRIM16 pAb (ATL-HPA066431)

Atlas Antibodies

Catalog No.:
ATL-HPA066431-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 16
Gene Name: TRIM16
Alternative Gene Name: EBBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047821: 83%, ENSRNOG00000003219: 86%
Entrez Gene ID: 10626
Uniprot ID: O95361
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YCKFKNTEDITFPSVYIGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAIVQRKYWTSKPEPST
Gene Sequence YCKFKNTEDITFPSVYIGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAIVQRKYWTSKPEPST
Gene ID - Mouse ENSMUSG00000047821
Gene ID - Rat ENSRNOG00000003219
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM16 pAb (ATL-HPA066431)
Datasheet Anti TRIM16 pAb (ATL-HPA066431) Datasheet (External Link)
Vendor Page Anti TRIM16 pAb (ATL-HPA066431) at Atlas Antibodies

Documents & Links for Anti TRIM16 pAb (ATL-HPA066431)
Datasheet Anti TRIM16 pAb (ATL-HPA066431) Datasheet (External Link)
Vendor Page Anti TRIM16 pAb (ATL-HPA066431)