Anti TRIM11 pAb (ATL-HPA043879)

Atlas Antibodies

Catalog No.:
ATL-HPA043879-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 11
Gene Name: TRIM11
Alternative Gene Name: BIA1, RNF92
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020455: 92%, ENSRNOG00000002915: 92%
Entrez Gene ID: 81559
Uniprot ID: Q96F44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLP
Gene Sequence KLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLP
Gene ID - Mouse ENSMUSG00000020455
Gene ID - Rat ENSRNOG00000002915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM11 pAb (ATL-HPA043879)
Datasheet Anti TRIM11 pAb (ATL-HPA043879) Datasheet (External Link)
Vendor Page Anti TRIM11 pAb (ATL-HPA043879) at Atlas Antibodies

Documents & Links for Anti TRIM11 pAb (ATL-HPA043879)
Datasheet Anti TRIM11 pAb (ATL-HPA043879) Datasheet (External Link)
Vendor Page Anti TRIM11 pAb (ATL-HPA043879)