Anti TRIM11 pAb (ATL-HPA028541)

Atlas Antibodies

Catalog No.: ATL-HPA028541-25

Protein Description: tripartite motif containing 11
Gene Name: TRIM11
Alternative Gene Name: BIA1, RNF92
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020455: 89%, ENSRNOG00000002915: 88%
Entrez Gene ID: 81559
Uniprot ID: Q96F44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDP
• Gene Sequence: LGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDP
• Gene ID - Mouse: ENSMUSG00000020455
• Gene ID - Rat: ENSRNOG00000002915
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIM11 pAb (ATL-HPA028541) – 2 Found

Zhang, Runa; Li, Si-Wei; Liu, Lijuan; Yang, Jun; Huang, Guofu; Sang, Yi. TRIM11 facilitates chemoresistance in nasopharyngeal carcinoma by activating the β-catenin/ABCC9 axis via p62-selective autophagic degradation of Daple. Oncogenesis. 2020;9(5):45. 

Xiao, Qiong; Wang, Chen-Yu; Gao, Chuan; Chen, Ji-Dong; Chen, Jing-Jing; Wang, Zhen; Ju, Lin-Gao; Tang, Shan-Bo; Yao, Jie; Li, Feng; Li, Lian-Yun; Wu, Min. Regulation of KDM5C stability and enhancer reprogramming in breast cancer. Cell Death & Disease. 2022;13(10):843.