Anti TRIB3 pAb (ATL-HPA055442)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055442-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TRIB3
Alternative Gene Name: C20orf97, dJ1103G7.3, TRB3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032715: 44%, ENSRNOG00000007319: 39%
Entrez Gene ID: 57761
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV |
| Gene Sequence | VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV |
| Gene ID - Mouse | ENSMUSG00000032715 |
| Gene ID - Rat | ENSRNOG00000007319 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TRIB3 pAb (ATL-HPA055442) | |
| Datasheet | Anti TRIB3 pAb (ATL-HPA055442) Datasheet (External Link) |
| Vendor Page | Anti TRIB3 pAb (ATL-HPA055442) at Atlas Antibodies |
| Documents & Links for Anti TRIB3 pAb (ATL-HPA055442) | |
| Datasheet | Anti TRIB3 pAb (ATL-HPA055442) Datasheet (External Link) |
| Vendor Page | Anti TRIB3 pAb (ATL-HPA055442) |