Anti TRIB3 pAb (ATL-HPA055442)

Atlas Antibodies

Catalog No.: ATL-HPA055442-25

Protein Description: tribbles pseudokinase 3
Gene Name: TRIB3
Alternative Gene Name: C20orf97, dJ1103G7.3, TRB3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032715: 44%, ENSRNOG00000007319: 39%
Entrez Gene ID: 57761
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV
• Gene Sequence: VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV
• Gene ID - Mouse: ENSMUSG00000032715
• Gene ID - Rat: ENSRNOG00000007319
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.