Anti TRIB3 pAb (ATL-HPA055442)

Atlas Antibodies

Catalog No.:
ATL-HPA055442-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: tribbles pseudokinase 3
Gene Name: TRIB3
Alternative Gene Name: C20orf97, dJ1103G7.3, TRB3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032715: 44%, ENSRNOG00000007319: 39%
Entrez Gene ID: 57761
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV
Gene Sequence VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV
Gene ID - Mouse ENSMUSG00000032715
Gene ID - Rat ENSRNOG00000007319
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIB3 pAb (ATL-HPA055442)
Datasheet Anti TRIB3 pAb (ATL-HPA055442) Datasheet (External Link)
Vendor Page Anti TRIB3 pAb (ATL-HPA055442) at Atlas Antibodies

Documents & Links for Anti TRIB3 pAb (ATL-HPA055442)
Datasheet Anti TRIB3 pAb (ATL-HPA055442) Datasheet (External Link)
Vendor Page Anti TRIB3 pAb (ATL-HPA055442)