Anti TRHR pAb (ATL-HPA055162)

Atlas Antibodies

Catalog No.:
ATL-HPA055162-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: thyrotropin releasing hormone receptor
Gene Name: TRHR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038760: 88%, ENSRNOG00000005048: 92%
Entrez Gene ID: 7201
Uniprot ID: P34981
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK
Gene Sequence ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK
Gene ID - Mouse ENSMUSG00000038760
Gene ID - Rat ENSRNOG00000005048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRHR pAb (ATL-HPA055162)
Datasheet Anti TRHR pAb (ATL-HPA055162) Datasheet (External Link)
Vendor Page Anti TRHR pAb (ATL-HPA055162) at Atlas Antibodies

Documents & Links for Anti TRHR pAb (ATL-HPA055162)
Datasheet Anti TRHR pAb (ATL-HPA055162) Datasheet (External Link)
Vendor Page Anti TRHR pAb (ATL-HPA055162)