Anti TREML4 pAb (ATL-HPA065044)

Atlas Antibodies

Catalog No.: ATL-HPA065044-25

Protein Description: triggering receptor expressed on myeloid cells-like 4
Gene Name: TREML4
Alternative Gene Name: TLT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051682: 47%, ENSRNOG00000042360: 47%
Entrez Gene ID: 285852
Uniprot ID: Q6UXN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTL
• Gene Sequence: TCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTL
• Gene ID - Mouse: ENSMUSG00000051682
• Gene ID - Rat: ENSRNOG00000042360
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.