Anti TREML4 pAb (ATL-HPA065044)

Atlas Antibodies

SKU:
ATL-HPA065044-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: triggering receptor expressed on myeloid cells-like 4
Gene Name: TREML4
Alternative Gene Name: TLT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051682: 47%, ENSRNOG00000042360: 47%
Entrez Gene ID: 285852
Uniprot ID: Q6UXN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTL
Gene Sequence TCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTL
Gene ID - Mouse ENSMUSG00000051682
Gene ID - Rat ENSRNOG00000042360
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TREML4 pAb (ATL-HPA065044)
Datasheet Anti TREML4 pAb (ATL-HPA065044) Datasheet (External Link)
Vendor Page Anti TREML4 pAb (ATL-HPA065044) at Atlas Antibodies

Documents & Links for Anti TREML4 pAb (ATL-HPA065044)
Datasheet Anti TREML4 pAb (ATL-HPA065044) Datasheet (External Link)
Vendor Page Anti TREML4 pAb (ATL-HPA065044)